Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A29 Rabbit Polyclonal Antibody (Biotin)

SLC25A29 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CACL, ORNT3, C14orf69

UniProt

Q8N8R3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A29

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034444

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hist2h2aa2 Protein Vector (Mouse) (pPM-C-His)
PV188941 500 ng

Hist2h2aa2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Salmonella typhi murA Recombinant Protein (N-His)
JN095022-01 50 µg

Salmonella typhi murA Recombinant Protein (N-His)

Sign In for Pricing
View Details
Salmonella typhi murA Recombinant Protein (N-His)
JN095022-02 100 µg

Salmonella typhi murA Recombinant Protein (N-His)

Sign In for Pricing
View Details
Salmonella typhi murA Recombinant Protein (N-His)
JN095022-03 1 mg

Salmonella typhi murA Recombinant Protein (N-His)

Sign In for Pricing
View Details
HT1080 (SMAD/TGFbeta) Luciferase Reporter Cell Line
ABC-RC441H 1 Vial

HT1080 (SMAD/TGFbeta) Luciferase Reporter Cell Line

Sign In for Pricing
View Details
DAP3 (Death Associated Protein 3)
MBS628765-01 0.1 mg

DAP3 (Death Associated Protein 3)

Sign In for Pricing
View Details