Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc16a3 Rabbit Polyclonal Antibody (HRP)

Slc16a3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mct3, Mct4

UniProt

P57787

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_109621

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP Mouse Monoclonal Antibody [Clone ID: GF-02]
AM03085PU-N 100 µg

GFAP Mouse Monoclonal Antibody [Clone ID: GF-02]

Sign In for Pricing
View Details
Cdc20 Mouse Gene Knockout Kit (CRISPR)
KN502962 1 Kit

Cdc20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BetacellULin (BTC) Human Gene Knockout Kit (CRISPR)
KN402483 1 Kit

BetacellULin (BTC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FTCD Goat Polyclonal Antibody
AB0160-200 600 µg

FTCD Goat Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF740 conjugate, 0.1mg/mL
BNC741762-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Anoctamin 3 (ANO3) activation kit by CRISPRa
GA111946 1 Kit

Human Anoctamin 3 (ANO3) activation kit by CRISPRa

Sign In for Pricing
View Details