Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A45 Rabbit Polyclonal Antibody (HRP)

SLC25A45 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8N413

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LOC283130

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001070709

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP164 (NM_014956) Human Tagged ORF Clone Lentiviral Particle
RC214663L4V 200 µL

CEP164 (NM_014956) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Lrrc8e shRNA (UAS) - Lentiviral mouse Lrrc8e shRNA (UAS, iRFP) (25)
GTR15263426 1 Vial

Lentiviral mouse Lrrc8e shRNA (UAS) - Lentiviral mouse Lrrc8e shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
OR2G2 Recombinant Protein (Human)
RP079917 100 µg

OR2G2 Recombinant Protein (Human)

Sign In for Pricing
View Details
PIRC101 Recombinant Protein (Human)
RP083340 100 µg

PIRC101 Recombinant Protein (Human)

Sign In for Pricing
View Details
XPO1 ELISA Kit (Human)
OKCD00866-96W 96 Well

XPO1 ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 15 Antibody (KRT15/1699) [Alexa Fluor 488]
NBP2-54463AF488 100 µL

Mouse Monoclonal Cytokeratin 15 Antibody (KRT15/1699) [Alexa Fluor 488]

Sign In for Pricing
View Details