Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A7 Rabbit Polyclonal Antibody (Biotin)

SLC39A7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KE4, HKE4, ZIP7, RING5, H2-KE4, D6S115E, D6S2244E

UniProt

Q92504

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001070984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Kv1.3/KCNA3 (Ser520) Blocking Peptide
MBS9616051-01 1 mg

Phospho-Kv1.3/KCNA3 (Ser520) Blocking Peptide

Sign In for Pricing
View Details
Phospho-Kv1.3/KCNA3 (Ser520) Blocking Peptide
MBS9616051-02 5x 1 mg

Phospho-Kv1.3/KCNA3 (Ser520) Blocking Peptide

Sign In for Pricing
View Details
Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) Polyclonal Antibody
CAU27454-01 100 µL

Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) Polyclonal Antibody

Sign In for Pricing
View Details
Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) Polyclonal Antibody
CAU27454-02 200 µL

Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) Polyclonal Antibody

Sign In for Pricing
View Details
Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) Polyclonal Antibody
CAU27454-03 1 mL

Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) Polyclonal Antibody

Sign In for Pricing
View Details
EXOC5 Antibody
MBS9603625-01 0.1 mL

EXOC5 Antibody

Sign In for Pricing
View Details