Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC37A4 Rabbit Polyclonal Antibody (Biotin)

SLC37A4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, TRG19, TRG-19, PRO0685

UniProt

O43826

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC37A4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT3 (Metallothionein 3, GIF, GIFB, GRIF) (APC)
248982-APC 100 µL

MT3 (Metallothionein 3, GIF, GIFB, GRIF) (APC)

Sign In for Pricing
View Details
Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit
MBS9323430-01 48 Well

Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit

Sign In for Pricing
View Details
Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit
MBS9323430-02 96 Well

Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit

Sign In for Pricing
View Details
Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit
MBS9323430-03 5x 96 Well

Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit

Sign In for Pricing
View Details
Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit
MBS9323430-04 10x 96 Well

Bovine Inactive serine protease PAMR1, PAMR1 ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 Omicron BQ.1.1 Variant Pseudovirus
orb1671375 1 mL

SARS-CoV-2 Omicron BQ.1.1 Variant Pseudovirus

Sign In for Pricing
View Details