Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC29A2 Rabbit Polyclonal Antibody (Biotin)

SLC29A2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ENT2, DER12, HNP36

UniProt

Q14542

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC29A2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

NP_001523

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LPP Rabbit Monoclonal Antibody
M01240 100 µL/Vial

Anti-LPP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ZNF137 Rabbit Polyclonal Antibody (BF594)
orb2394466 100 µL

ZNF137 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Corning CellBIND 175cm2 Angled Neck Cell Culture Flask with Vent Cap and Bar Code
431328 84 / PCK

Corning CellBIND 175cm2 Angled Neck Cell Culture Flask with Vent Cap and Bar Code

Sign In for Pricing
View Details
Tissue, Array, Human Adult Normal, Multi, tissue (8) II, Major Organ, Esophagus, Stomach, Small intestine, Colon, Uterus, Placenta, Bladder, Adipose (Paraffin)
MBS639660-01 5 Arrays

Tissue, Array, Human Adult Normal, Multi, tissue (8) II, Major Organ, Esophagus, Stomach, Small intestine, Colon, Uterus, Placenta, Bladder, Adipose (Paraffin)

Sign In for Pricing
View Details
Tissue, Array, Human Adult Normal, Multi, tissue (8) II, Major Organ, Esophagus, Stomach, Small intestine, Colon, Uterus, Placenta, Bladder, Adipose (Paraffin)
MBS639660-02 5x 5 Arrays

Tissue, Array, Human Adult Normal, Multi, tissue (8) II, Major Organ, Esophagus, Stomach, Small intestine, Colon, Uterus, Placenta, Bladder, Adipose (Paraffin)

Sign In for Pricing
View Details
Lentiviral mouse Cltb shRNA (UAS) - Lentiviral mouseCltb shRNA (UAS, GFP) (25)
GTR15177128 1 Vial

Lentiviral mouse Cltb shRNA (UAS) - Lentiviral mouseCltb shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details