Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC29A2 Rabbit Polyclonal Antibody (Biotin)

SLC29A2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ENT2, DER12, HNP36

UniProt

Q14542

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC29A2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001523

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag
057374-01 10 µg

Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag
057374-02 50 µg

Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag
057374-03 100 µg

Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag
057374-04 200 µg

Gastric Intrinsic Factor (GIF), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Human Solute carrier family 23 member 1, SLC23A1 ELISA KIT
ELI-38740h 96 Tests

Human Solute carrier family 23 member 1, SLC23A1 ELISA KIT

Sign In for Pricing
View Details
CACNA1E siRNA Oligos set (Human)
14884171 3x 5 nmol

CACNA1E siRNA Oligos set (Human)

Sign In for Pricing
View Details