Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc31a1 Rabbit Polyclonal Antibody (Biotin)

Slc31a1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ctr, Ctr1, AI787263, AU016967, 4930445G01Rik

UniProt

Q8K211

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNVNLLFSGLV

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_780299

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pDNR-LIB-Rpl9 Plasmid
PVT42034 2 µg

pDNR-LIB-Rpl9 Plasmid

Sign In for Pricing
View Details
CCDC47 Knockout HEK293T Polyclonal Cells
ARG43014 1 Million

CCDC47 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
METTL25 Polyclonal Antibody, FITC Conjugated
A66632-100 100 µL

METTL25 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Bdh2 Mouse siRNA Oligo Duplex (Locus ID 69772)
SR406850 1 Kit

Bdh2 Mouse siRNA Oligo Duplex (Locus ID 69772)

Sign In for Pricing
View Details
Rat Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL) CLIA Kit
MBS2001241-01 24 Strip Well

Rat Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL) CLIA Kit

Sign In for Pricing
View Details
Rat Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL) CLIA Kit
MBS2001241-02 48 Well

Rat Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL) CLIA Kit

Sign In for Pricing
View Details