Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc5a2 Rabbit Polyclonal Antibody (Biotin)

Slc5a2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sgl, Sglt2

UniProt

Q923I7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSTCYQPRPDSYHLLRDPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_573517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd38 Rat Monoclonal Antibody [Clone ID: NIMR-5]
AM08041FC-N 500 µg

Cd38 Rat Monoclonal Antibody [Clone ID: NIMR-5]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD16 Antibody[3G8]
E-AB-F1236L-01 20 Tests

Elab Fluor® 488 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD16 Antibody[3G8]
E-AB-F1236L-02 100 Tests

Elab Fluor® 488 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD16 Antibody[3G8]
E-AB-F1236L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Human RCC2 activation kit by CRISPRa
GA111062 1 Kit

Human RCC2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL
BNC401133-100 1x 100 µL

CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details