Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc5a2 Rabbit Polyclonal Antibody (HRP)

Slc5a2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sgl, Sglt2

UniProt

Q923I7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSTCYQPRPDSYHLLRDPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_573517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mucosal Addressin Cell Adhesion Molecule 1 (MAdCAM1) ELISA Kit
RDR-MAdCAM1-Mu-96Tests 96 Tests

Mouse Mucosal Addressin Cell Adhesion Molecule 1 (MAdCAM1) ELISA Kit

Sign In for Pricing
View Details
BRI3 Human qPCR Primer Pair (NM_015379)
HP211595 200 Reactions

BRI3 Human qPCR Primer Pair (NM_015379)

Sign In for Pricing
View Details
MYPT1, phosphorylated (Thr853/Thr850) (Myosin Phosphatase 1) (MaxLight 405) discontinued
M9925-08-ML405 100 µL

MYPT1, phosphorylated (Thr853/Thr850) (Myosin Phosphatase 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Dipyridamole tripiperidine
FD22536-01 2 mg

Dipyridamole tripiperidine

Sign In for Pricing
View Details
Dipyridamole tripiperidine
FD22536-02 5 mg

Dipyridamole tripiperidine

Sign In for Pricing
View Details
Dipyridamole tripiperidine
FD22536-03 10 mg

Dipyridamole tripiperidine

Sign In for Pricing
View Details