Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC43A1 Rabbit Polyclonal Antibody (HRP)

SLC43A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LAT3, PB39, POV1, R00504

UniProt

O75387

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC43A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003618

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creatine Kinase-BB (CK-BB) (CKBB/1268), CF640R conjugate, 0.1mg/mL
BNC401268-100 1x 100 µL

Creatine Kinase-BB (CK-BB) (CKBB/1268), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF568 conjugate, 0.1mg/mL
BNC680396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FHL1 (NM_001159702) Human Over-expression Lysate
LY431283 100 µg

FHL1 (NM_001159702) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Adh1 activation kit by CRISPRa
GA200083 1 Kit

Mouse Adh1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS621127 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF647 conjugate, 0.1mg/mL
BNC473131-100 1x 100 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details