Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A14 Rabbit Polyclonal Antibody (HRP)

SLC25A14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UCP5, BMCP1

UniProt

Q5JY88

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

CAI42439

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 750)
MBS6444642-01 0.1 mL

CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 750)

Sign In for Pricing
View Details
CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 750)
MBS6444642-02 5x 0.1 mL

CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 750)

Sign In for Pricing
View Details
RNF38 sgRNA CRISPR Lentivector (Human) (Target 3)
K1836104 1.0 µg DNA

RNF38 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Phospho-Cdc6 (Ser54) Rabbit Polyclonal Antibody (APC-Cy7)
orb1595440 100 µL

Phospho-Cdc6 (Ser54) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
A 803467
2976/10 10 mg

A 803467

Sign In for Pricing
View Details
S100A12 Rabbit pAb
E45R19128N-100 100 µL

S100A12 Rabbit pAb

Sign In for Pricing
View Details