Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A7 Rabbit Polyclonal Antibody (HRP)

SLC7A7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LPI, LAT3, MOP-2, Y+LAT1, y+LAT-1

UniProt

Q9UM01

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC7A7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WGTLVQDIFTYAKVLALIGIVRLGQGASTHFENSFEGSSFAVGDI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-A Helix pomatia Lectin (Edible Snail) -HPA-
B-3601-2 2 mL

Anti-A Helix pomatia Lectin (Edible Snail) -HPA-

Sign In for Pricing
View Details
CDY2B Mouse Monoclonal Antibody [Clone ID: OTI2G1]
CF810422 100 µg

CDY2B Mouse Monoclonal Antibody [Clone ID: OTI2G1]

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561940 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Human LOXL3 activation kit by CRISPRa
GA113661 1 Kit

Human LOXL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Gephyrin (GPHN) Rabbit Polyclonal Antibody
TA376708 100 µL

Gephyrin (GPHN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IP3 Receptor Antibody
KC-36877-01 50 μL

IP3 Receptor Antibody

Sign In for Pricing
View Details