Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a3r2 Rabbit Polyclonal Antibody (HRP)

Slc9a3r2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Si, Sr, E3k, Oct, Nher, Sip1, Tka-, Octs2, Sip-1, Tka-1, E3karp, Nherf2, Sryip1, NHERF-2, 0610011L07Rik, 1200011K07Rik, 2010007A20Rik

UniProt

Q9JHL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HFKRLRVIPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075938

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcalumenin (SRL) (NM_001098814) Human Over-expression Lysate
LY420346 100 µg

Sarcalumenin (SRL) (NM_001098814) Human Over-expression Lysate

Sign In for Pricing
View Details
PCR Strip Tubes
P3010-A-O 120 Units/Pack

PCR Strip Tubes

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Monkey IgG
HAF-2305-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Monkey IgG

Sign In for Pricing
View Details
PDE9A (NM_001001568) Human Over-expression Lysate
LC424385 20 µg

PDE9A (NM_001001568) Human Over-expression Lysate

Sign In for Pricing
View Details
TDRD3 (NM_030794) Human Recombinant Protein
TP307081 20 µg

TDRD3 (NM_030794) Human Recombinant Protein

Sign In for Pricing
View Details
LipidSpotTM 610 Lipid Droplet Stain
#70069 1x 125 µL

LipidSpotTM 610 Lipid Droplet Stain

Sign In for Pricing
View Details