Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC12A4 Rabbit Polyclonal Antibody (Biotin)

SLC12A4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KCC1, hKCC1, CTC-479C5.17

UniProt

Q9UP95

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkA (NTRK1) (Extracell. Dom) mouse monoclonal antibody, clone 165126
MO15018-500 500 µg

TrkA (NTRK1) (Extracell. Dom) mouse monoclonal antibody, clone 165126

Sign In for Pricing
View Details
Tissue Array, Human, BioAssayTM Normal breast tissue (multi-sites) discontinued
T5596-0291 1Array

Tissue Array, Human, BioAssayTM Normal breast tissue (multi-sites) discontinued

Sign In for Pricing
View Details
TEX13B (NM_031273) Human Tagged Lenti ORF Clone
RC220609L3 10 µg

TEX13B (NM_031273) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Complement C3, C3c (FITC)
MBS6003249-01 1 mL

Complement C3, C3c (FITC)

Sign In for Pricing
View Details
Complement C3, C3c (FITC)
MBS6003249-02 5x 1 mL

Complement C3, C3c (FITC)

Sign In for Pricing
View Details
CA3, ID (CA3, Carbonic anhydrase 3, Carbonate dehydratase III, Carbonic anhydrase III) (APC)
MBS6280222-01 0.2 mL

CA3, ID (CA3, Carbonic anhydrase 3, Carbonate dehydratase III, Carbonic anhydrase III) (APC)

Sign In for Pricing
View Details