Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC12A4 Rabbit Polyclonal Antibody (FITC)

SLC12A4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KCC1, hKCC1, CTC-479C5.17

UniProt

Q9UP95

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acta1b (FITC)
554331-01 50 µg

Acta1b (FITC)

Sign In for Pricing
View Details
Acta1b (FITC)
554331-02 100 µg

Acta1b (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal Mitochondria Antibody (SPM198) - Azide and BSA Free
NBP2-34745-0.1mg 0.1 mg

Mouse Monoclonal Mitochondria Antibody (SPM198) - Azide and BSA Free

Sign In for Pricing
View Details
VPS25 Polyclonal Antibody, FITC Conjugated
A67908-100 100 µL

VPS25 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. cerevisiae), HNPCC4, PMS2CL, PMSL2) (MaxLight 490)
MBS6207978-01 0.1 mL

PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. cerevisiae), HNPCC4, PMS2CL, PMSL2) (MaxLight 490)

Sign In for Pricing
View Details
PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. cerevisiae), HNPCC4, PMS2CL, PMSL2) (MaxLight 490)
MBS6207978-02 5x 0.1 mL

PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. cerevisiae), HNPCC4, PMS2CL, PMSL2) (MaxLight 490)

Sign In for Pricing
View Details