Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC43A3 Rabbit Polyclonal Antibody (Biotin)

SLC43A3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EEG1, ENBT1, FOAP-13, PRO1659, SEEEG-1

UniProt

Q8NBI5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC43A3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

NP_060081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA12 protein, Human, Recombinant (His)
E51P91671 20 µg

PCDHGA12 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) MED22 Polyclonal Antibody
MBS7140267 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) MED22 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human C5orf15 shRNA (UAS) - Lentiviral human C5orf15 shRNA (UAS, GFP) plasmid
GTR15311293 1 Vial

Lentiviral human C5orf15 shRNA (UAS) - Lentiviral human C5orf15 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal ZNF239 Antibody (PCRP-ZNF239-2A10) [DyLight 594]
NBP3-24148DL594 0.1 mL

Mouse Monoclonal ZNF239 Antibody (PCRP-ZNF239-2A10) [DyLight 594]

Sign In for Pricing
View Details
Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated
orb3006139-01 20 µg

Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated
orb3006139-02 100 µg

Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated

Sign In for Pricing
View Details