Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC43A3 Rabbit Polyclonal Antibody (FITC)

SLC43A3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EEG1, ENBT1, FOAP-13, PRO1659, SEEEG-1

UniProt

Q8NBI5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC43A3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005274010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IFN-alpha/ IFNA1/ IFN Protein, His-SUMO, E.coli-500ug
QP7402-ec-500ug 500ug

Recombinant Human IFN-alpha/ IFNA1/ IFN Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
SPC12 siRNA (m)
sc-153729 10 µM

SPC12 siRNA (m)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human FCMR (Fc fragment of IgM receptor) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3860K Each

Magic™ Membrane Protein Human FCMR (Fc fragment of IgM receptor) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
Troponin I, slow skeletal muscle
orb1645276-01 50 µg

Troponin I, slow skeletal muscle

Sign In for Pricing
View Details
Troponin I, slow skeletal muscle
orb1645276-02 100 µg

Troponin I, slow skeletal muscle

Sign In for Pricing
View Details
Troponin I, slow skeletal muscle
orb1645276-03 1 mg

Troponin I, slow skeletal muscle

Sign In for Pricing
View Details