Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC43A3 Rabbit Polyclonal Antibody (HRP)

SLC43A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EEG1, ENBT1, FOAP-13, PRO1659, SEEEG-1

UniProt

Q8NBI5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC43A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005274010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit
MBS747483-01 48 Well

Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit

Sign In for Pricing
View Details
Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit
MBS747483-02 96 Well

Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit

Sign In for Pricing
View Details
Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit
MBS747483-03 5x 96 Well

Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit

Sign In for Pricing
View Details
Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit
MBS747483-04 10x 96 Well

Canine Chemokine C-X-C-Motif Receptor 4 ELISA Kit

Sign In for Pricing
View Details
Anti-Human AMH Monoclonal Antibody (1A376)
MBS1586533-01 0.05 mg

Anti-Human AMH Monoclonal Antibody (1A376)

Sign In for Pricing
View Details
Anti-Human AMH Monoclonal Antibody (1A376)
MBS1586533-02 0.1 mg

Anti-Human AMH Monoclonal Antibody (1A376)

Sign In for Pricing
View Details