Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A4 Rabbit Polyclonal Antibody (HRP)

SLC5A4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAAT1, SGLT3, DJ90G24.4

UniProt

Q9NY91

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC5A4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055042

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Corynebacterium Diphtheriae xseA Protein (aa 1-413)
VAng-Lsx2996-1mgEcoli 1 mg (E. coli)

Recombinant Corynebacterium Diphtheriae xseA Protein (aa 1-413)

Sign In for Pricing
View Details
Slc6a2 3'UTR Lenti-reporter-Luc Vector
44257084 1.0 µg

Slc6a2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Klk5 (NM_026806) Mouse Tagged Lenti ORF Clone
MR221193L4 10 µg

Klk5 (NM_026806) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Transcription repressor MYB4 (MYB4)
MBS1432290-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Transcription repressor MYB4 (MYB4)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Transcription repressor MYB4 (MYB4)
MBS1432290-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Transcription repressor MYB4 (MYB4)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Transcription repressor MYB4 (MYB4)
MBS1432290-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Transcription repressor MYB4 (MYB4)

Sign In for Pricing
View Details