Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc25a15 Rabbit Polyclonal Antibody (HRP)

Slc25a15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Or, Ornt1, D630044L02Rik

UniProt

Q9WVD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_851842

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHDC7B activation kit by CRISPRa
GA114415 1 Kit

Human KLHDC7B activation kit by CRISPRa

Sign In for Pricing
View Details
Protonex™ Red 670 maleimide
21184-AAT 1 mg

Protonex™ Red 670 maleimide

Sign In for Pricing
View Details
Aflatoxin B2
TRC-A357465-5MG 5 mg

Aflatoxin B2

Sign In for Pricing
View Details
2-((1R,4R)-4-(4-Chlorophenyl)cyclohexyl)-1-oxo-1H-indene-3-carboxylic Acid
TRC-C377580-10MG 10 mg

2-((1R,4R)-4-(4-Chlorophenyl)cyclohexyl)-1-oxo-1H-indene-3-carboxylic Acid

Sign In for Pricing
View Details
LRP1 Recombinant Rabbit Monoclonal Antibody [SA0290]
ET1601-1 100 µL

LRP1 Recombinant Rabbit Monoclonal Antibody [SA0290]

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF405S conjugate, 0.1mg/mL
BNC042329-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details