Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A44 Rabbit Polyclonal Antibody (HRP)

SLC25A44 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ90431, KIAA0446, RP11-54H19.3

UniProt

Q96H78

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC25A44

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKLSLRPELVDSRH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055470

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIBU 1361 Dihydrochloride
TRC-B377008-2.5MG 2.5 mg

BIBU 1361 Dihydrochloride

Sign In for Pricing
View Details
PCDHB8 Mouse Monoclonal Antibody [Clone ID: OTI1F6]
CF812703 100 µg

PCDHB8 Mouse Monoclonal Antibody [Clone ID: OTI1F6]

Sign In for Pricing
View Details
Human Heat Shock 70kDa Protein 5 (HSPA5) ELISA Kit
RDR-HSPA5-Hu-01 96 Tests

Human Heat Shock 70kDa Protein 5 (HSPA5) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock 70kDa Protein 5 (HSPA5) ELISA Kit
RDR-HSPA5-Hu-02 48 Tests

Human Heat Shock 70kDa Protein 5 (HSPA5) ELISA Kit

Sign In for Pricing
View Details
Cefpirome Sulfate
TRC-C243500-1G 1 g

Cefpirome Sulfate

Sign In for Pricing
View Details
Recombinant Human Carboxylesterase 1/CES1 Protein (His Tag)
PKSH032167-01 10 µg

Recombinant Human Carboxylesterase 1/CES1 Protein (His Tag)

Sign In for Pricing
View Details