Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35C2 Rabbit Polyclonal Antibody (FITC)

SLC35C2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CGI-15, OVCOV1, C20orf5, BA394O2.1

UniProt

Q9NQQ7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse SLC35C2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001268386.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit
MBS7218101-01 48 Well

Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit
MBS7218101-02 96 Well

Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit
MBS7218101-03 5x 96 Well

Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit
MBS7218101-04 10x 96 Well

Rabbit Olfactory receptor 51F1 (OR51F1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Methanohalobium evestigatum Tetrahydromethanopterin S-methyltransferase subunit A (mtrA), partial
MBS1003476-01 0.05 mg (Baculovirus)

Recombinant Methanohalobium evestigatum Tetrahydromethanopterin S-methyltransferase subunit A (mtrA), partial

Sign In for Pricing
View Details
Recombinant Methanohalobium evestigatum Tetrahydromethanopterin S-methyltransferase subunit A (mtrA), partial
MBS1003476-02 0.5 mg (E-Coli)

Recombinant Methanohalobium evestigatum Tetrahydromethanopterin S-methyltransferase subunit A (mtrA), partial

Sign In for Pricing
View Details