Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A6 Rabbit Polyclonal Antibody (FITC)

SLC2A6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GLUT6, GLUT9, HSA011372

UniProt

Q9UGQ3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC2A6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_060055

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C / EBP delta / epsilon Blocking Peptide
abx062412-01 1 mg

C / EBP delta / epsilon Blocking Peptide

Sign In for Pricing
View Details
C / EBP delta / epsilon Blocking Peptide
abx062412-02 5 mg

C / EBP delta / epsilon Blocking Peptide

Sign In for Pricing
View Details
Rbpjl-set siRNA/shRNA/RNAi Lentivector (Rat)
38711096 4x 500 ng

Rbpjl-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) CLIA Kit
abx494025-01 96 Tests

Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) CLIA Kit

Sign In for Pricing
View Details
Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) CLIA Kit
abx494025-02 5x 96 Tests

Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) CLIA Kit

Sign In for Pricing
View Details
Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) CLIA Kit
abx494025-03 10x 96 Tests

Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) CLIA Kit

Sign In for Pricing
View Details