Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A38 Rabbit Polyclonal Antibody (FITC)

SLC25A38 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SIDBA2

UniProt

Q96DW6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC25A38

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_060345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Laminin alpha 1 (LAMA1) ELISA Kit
EIA07454Rb 1 Kit

Rabbit Laminin alpha 1 (LAMA1) ELISA Kit

Sign In for Pricing
View Details
Human SBNO2 activation kit by CRISPRa
GA107899 1 Kit

Human SBNO2 activation kit by CRISPRa

Sign In for Pricing
View Details
NR2E1, ID (NR2E1, TLX, Nuclear receptor subfamily 2 group E member 1, Nuclear receptor TLX, Protein tailless homolog) (MaxLight 490)
MBS6326573-01 0.1 mL

NR2E1, ID (NR2E1, TLX, Nuclear receptor subfamily 2 group E member 1, Nuclear receptor TLX, Protein tailless homolog) (MaxLight 490)

Sign In for Pricing
View Details
NR2E1, ID (NR2E1, TLX, Nuclear receptor subfamily 2 group E member 1, Nuclear receptor TLX, Protein tailless homolog) (MaxLight 490)
MBS6326573-02 5x 0.1 mL

NR2E1, ID (NR2E1, TLX, Nuclear receptor subfamily 2 group E member 1, Nuclear receptor TLX, Protein tailless homolog) (MaxLight 490)

Sign In for Pricing
View Details
Defa39 Mouse siRNA Oligo Duplex (Locus ID 382000)
SR401697 1 Kit

Defa39 Mouse siRNA Oligo Duplex (Locus ID 382000)

Sign In for Pricing
View Details
ZAP70 Rabbit mAb (AMR12090N)
AMR12090N-01 50 µL

ZAP70 Rabbit mAb (AMR12090N)

Sign In for Pricing
View Details