Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35A5 Rabbit Polyclonal Antibody (FITC)

SLC35A5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp434E102, FLJ11130, FLJ20730, FLJ25973

UniProt

Q9BS91

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC35A5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_060415

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)
MBS2103543-01 5x 96 Tests

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)
MBS2103543-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)
MBS2103543-03 10x 96 Tests

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)
MBS2103543-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Lentiviral human NBPF10 shRNA (UAS) - Lentiviral human NBPF10 shRNA (UAS) (100)
GTR15088206 1 Vial

Lentiviral human NBPF10 shRNA (UAS) - Lentiviral human NBPF10 shRNA (UAS) (100)

Sign In for Pricing
View Details
MCM7 Antibody
orb3073658-01 20 µg

MCM7 Antibody

Sign In for Pricing
View Details