Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35C1 Rabbit Polyclonal Antibody (HRP)

SLC35C1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDG2C, FUCT1

UniProt

Q96A29

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC35C1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIF (NM_002309) Human Tagged Lenti ORF Clone
RC210818L2 10 µg

LIF (NM_002309) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans tir-1 Polyclonal Antibody
MBS9001445 Inquire

Rabbit anti-Caenorhabditis elegans tir-1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit
MBS2707152-01 24 Strip Well

Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit
MBS2707152-02 48 Well

Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit
MBS2707152-03 96 Well

Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit
MBS2707152-04 5x 96 Well

Human Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) ELISA Kit

Sign In for Pricing
View Details