Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A15 Rabbit Polyclonal Antibody (HRP)

SLC22A15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLIPT1, PRO34686

UniProt

Q8IZD6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC22A15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WDLAELLPNQSHGNQSAGEDQAFGDWLLTANGSEIHKHVHFSSSFTSIAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005271063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA1 Rabbit Monoclonal Antibody [Clone ID: R07-5B7]
TA421965 100 µL

NCOA1 Rabbit Monoclonal Antibody [Clone ID: R07-5B7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS704491 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
MCM4 (NM_005914) Human Recombinant Protein
TP312292M 100 µg

MCM4 (NM_005914) Human Recombinant Protein

Sign In for Pricing
View Details
Pumilio 1 (PUM1) Human Gene Knockout Kit (CRISPR)
KN401219 1 Kit

Pumilio 1 (PUM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DCPS activation kit by CRISPRa
GA109171 1 Kit

Human DCPS activation kit by CRISPRa

Sign In for Pricing
View Details
(1R,2S)-anti-Nicotine N'-Oxide Hydrate
TRC-N427505-2.5MG 2.5 mg

(1R,2S)-anti-Nicotine N'-Oxide Hydrate

Sign In for Pricing
View Details