Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A15 Rabbit Polyclonal Antibody (HRP)

SLC22A15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLIPT1, PRO34686

UniProt

Q8IZD6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC22A15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WDLAELLPNQSHGNQSAGEDQAFGDWLLTANGSEIHKHVHFSSSFTSIAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005271063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)
PKSM040581-01 100 µg

Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)
PKSM040581-02 1 mg

Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)

Sign In for Pricing
View Details
Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: AT10F1]
AM09370PU-N 100 µL

Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: AT10F1]

Sign In for Pricing
View Details
Sodium Phosphate Monobasic Anhydrous
TRC-S673260-5G 5 g

Sodium Phosphate Monobasic Anhydrous

Sign In for Pricing
View Details
C1orf43 Human Gene Knockout Kit (CRISPR)
KN400875 1 Kit

C1orf43 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PerCP Anti-Human CD38 Antibody[HIT2]
E-AB-F1058F-01 20 Tests

PerCP Anti-Human CD38 Antibody[HIT2]

Sign In for Pricing
View Details