Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A11 Rabbit Polyclonal Antibody (HRP)

SLC22A11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OAT4, hOAT4

UniProt

Q9NSA0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_060954

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF2, Recombinant, Human, aa143-288 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2)
470230-01 100 µg

FGF2, Recombinant, Human, aa143-288 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2)

Sign In for Pricing
View Details
FGF2, Recombinant, Human, aa143-288 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2)
470230-02 500 µg

FGF2, Recombinant, Human, aa143-288 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2)

Sign In for Pricing
View Details
Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit
MBS7238370-01 48 Well

Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit
MBS7238370-02 96 Well

Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit
MBS7238370-03 5x 96 Well

Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit
MBS7238370-04 10x 96 Well

Rabbit F-box/WD repeat-containing protein 11 (FBXW11) ELISA Kit

Sign In for Pricing
View Details