Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC37A1 Rabbit Polyclonal Antibody (FITC)

SLC37A1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G3PP

UniProt

P57057

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC37A1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061837

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
12615156 3x 1.0 µg DNA

ATF5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
TYW1 AAV Vector (Mouse) (CMV)
48899105 1 µg

TYW1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Myosin, Cardiac, Heavy Chain (Alpha MHC, ASD3, CMD1S, CMH1, MGC138376, MGC138378, MPD1, MYH6, MYH7, MYHC, MyHC-alpha, MYHCA, MyHC-beta, MYHCB, Myosin Heavy Chain Cardiac Muscle alpha Isoform, Myosin Heavy Chain Cardiac Muscle beta Isoform, Myosin Heavy Polypeptide 7 Cardiac Muscle beta)
M9850-11C 100 µg

Myosin, Cardiac, Heavy Chain (Alpha MHC, ASD3, CMD1S, CMH1, MGC138376, MGC138378, MPD1, MYH6, MYH7, MYHC, MyHC-alpha, MYHCA, MyHC-beta, MYHCB, Myosin Heavy Chain Cardiac Muscle alpha Isoform, Myosin Heavy Chain Cardiac Muscle beta Isoform, Myosin Heavy Polypeptide 7 Cardiac Muscle beta)

Sign In for Pricing
View Details
Recombinant Human CLEC12A Protein, His Tag
E40KMP1409 20 µg

Recombinant Human CLEC12A Protein, His Tag

Sign In for Pricing
View Details
(Mouse) Med15 Antibody (C-term)
orb1926469-01 50 µL

(Mouse) Med15 Antibody (C-term)

Sign In for Pricing
View Details
(Mouse) Med15 Antibody (C-term)
orb1926469-02 100 µL

(Mouse) Med15 Antibody (C-term)

Sign In for Pricing
View Details