Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC37A1 Rabbit Polyclonal Antibody (HRP)

SLC37A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G3PP

UniProt

P57057

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC37A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061837

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit
MBS9337587-01 48 Well

Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit

Sign In for Pricing
View Details
Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit
MBS9337587-02 96 Well

Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit

Sign In for Pricing
View Details
Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit
MBS9337587-03 5x 96 Well

Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit

Sign In for Pricing
View Details
Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit
MBS9337587-04 10x 96 Well

Mouse snRNA-activating protein complex subunit 2, SNAPC2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Dolichyl Diphosphooligosaccharide Protein Glycosyltransferase (DDOST)
TRV-0010958-01 10 µg

Recombinant Dolichyl Diphosphooligosaccharide Protein Glycosyltransferase (DDOST)

Sign In for Pricing
View Details
Recombinant Dolichyl Diphosphooligosaccharide Protein Glycosyltransferase (DDOST)
TRV-0010958-02 50 µg

Recombinant Dolichyl Diphosphooligosaccharide Protein Glycosyltransferase (DDOST)

Sign In for Pricing
View Details