Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial

Product Specifications

Product Name Alternative

(Protein K-12)

Abbreviation

Recombinant Human SECTM1 protein, partial

Gene Name

SECTM1

UniProt

Q8WVN6

Expression Region

29-145aa

Organism

Homo sapiens (Human)

Target Sequence

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

May be involved in thymocyte signaling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.8 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD2 (NM_001278709) Human Untagged Clone
SC337369 10 µg

PSMD2 (NM_001278709) Human Untagged Clone

Sign In for Pricing
View Details
Gpr152 sgRNA CRISPR Lentivector set (Mouse)
K3603001 3x 1.0 µg

Gpr152 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
C-Cbl, phosphorylated (Tyr700)
047591 100 µL

C-Cbl, phosphorylated (Tyr700)

Sign In for Pricing
View Details
HSP90B1 Conjugated Antibody
MBS9446226-01 0.1 mL (Biotin)

HSP90B1 Conjugated Antibody

Sign In for Pricing
View Details
HSP90B1 Conjugated Antibody
MBS9446226-02 0.1 mL (AF350)

HSP90B1 Conjugated Antibody

Sign In for Pricing
View Details
HSP90B1 Conjugated Antibody
MBS9446226-03 0.1 mL (AF405)

HSP90B1 Conjugated Antibody

Sign In for Pricing
View Details