Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A14 Rabbit Polyclonal Antibody (HRP)

SLC7A14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PPP1R142

UniProt

Q8TBB6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC7A14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_066000

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf36 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G7]
TA808244AM 100 µL

C4orf36 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G7]

Sign In for Pricing
View Details
VPS28 Human Gene Knockout Kit (CRISPR)
KN400025 1 Kit

VPS28 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS708885 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Factor XIIIa (F13A1) (NM_000129) Human Recombinant Protein
TP306464L 1 mg

Factor XIIIa (F13A1) (NM_000129) Human Recombinant Protein

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]
TA800125AM 100 µL

SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details