Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC8A1 Rabbit Polyclonal Antibody (FITC)

SLC8A1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NCX1

UniProt

P32418

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC8A1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106271.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-20703R-BF488 100 µL

CREB-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Tf Antibody
orb863168 2 mg

Tf Antibody

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (Ser139) (H2A histone family member X, H2A.FX, H2A/X, H2AFX, H2AX)
MBS603984-01 0.025 mg

Histone H2A.X, phosphorylated (Ser139) (H2A histone family member X, H2A.FX, H2A/X, H2AFX, H2AX)

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (Ser139) (H2A histone family member X, H2A.FX, H2A/X, H2AFX, H2AX)
MBS603984-02 0.1 mg

Histone H2A.X, phosphorylated (Ser139) (H2A histone family member X, H2A.FX, H2A/X, H2AFX, H2AX)

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (Ser139) (H2A histone family member X, H2A.FX, H2A/X, H2AFX, H2AX)
MBS603984-03 5x 0.1 mg

Histone H2A.X, phosphorylated (Ser139) (H2A histone family member X, H2A.FX, H2A/X, H2AFX, H2AX)

Sign In for Pricing
View Details
Printed with Looped cap Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, 1000 un, DNase/RNase free - ABDOS
P10346 1000 Units/Pack

Printed with Looped cap Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details