Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A28 Rabbit Polyclonal Antibody (HRP)

SLC25A28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MFRN2, MRS4L, MRS3/4, NPD016

UniProt

Q96A46

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_112489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZMYND19 Protein (His Tag)
PKSH033236-01 10 µg

Recombinant Human ZMYND19 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ZMYND19 Protein (His Tag)
PKSH033236-02 50 µg

Recombinant Human ZMYND19 Protein (His Tag)

Sign In for Pricing
View Details
C11orf51 (ANAPC15) Human Gene Knockout Kit (CRISPR)
KN401325 1 Kit

C11orf51 (ANAPC15) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LGALS9C (NM_001040078) Human Recombinant Protein
TP320215M 100 µg

LGALS9C (NM_001040078) Human Recombinant Protein

Sign In for Pricing
View Details
Mini Sample Mouse DPP4 (Dipeptidyl Peptidase IV) ELISA Kit
E-MSEL-M0042-01 24 Tests

Mini Sample Mouse DPP4 (Dipeptidyl Peptidase IV) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse DPP4 (Dipeptidyl Peptidase IV) ELISA Kit
E-MSEL-M0042-02 48 Tests

Mini Sample Mouse DPP4 (Dipeptidyl Peptidase IV) ELISA Kit

Sign In for Pricing
View Details