Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC41A2 Rabbit Polyclonal Antibody (HRP)

SLC41A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLC41A1-L1

UniProt

Q96JW4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC41A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB22A (Ras-related Protein Rab-22A, RAB22, Rab-22) (MaxLight 490)
MBS6202793-01 0.1 mL

RAB22A (Ras-related Protein Rab-22A, RAB22, Rab-22) (MaxLight 490)

Sign In for Pricing
View Details
RAB22A (Ras-related Protein Rab-22A, RAB22, Rab-22) (MaxLight 490)
MBS6202793-02 5x 0.1 mL

RAB22A (Ras-related Protein Rab-22A, RAB22, Rab-22) (MaxLight 490)

Sign In for Pricing
View Details
human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit
MBS704987-01 24 Well (LIMIT 1)

human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit

Sign In for Pricing
View Details
human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit
MBS704987-02 48 Well

human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit

Sign In for Pricing
View Details
human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit
MBS704987-03 96 Well

human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit

Sign In for Pricing
View Details
human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit
MBS704987-04 5x 96 Well

human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit

Sign In for Pricing
View Details