Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC9A7 Rabbit Polyclonal Antibody (HRP)

SLC9A7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NHE7, NHE-7, MRX108, SLC9A6

UniProt

Q96T83

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC9A7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115980

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Barx2 activation kit by CRISPRa
GA200370 1 Kit

Mouse Barx2 activation kit by CRISPRa

Sign In for Pricing
View Details
PR3 (PRTN3) Human Gene Knockout Kit (CRISPR)
KN420949 1 Kit

PR3 (PRTN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pure Narcissus pseudonarcissus Lectin (Daffodil) -NPA-
L-8006-1 1 mg

Pure Narcissus pseudonarcissus Lectin (Daffodil) -NPA-

Sign In for Pricing
View Details
Tigit Mouse Gene Knockout Kit (CRISPR)
KN517567 1 Kit

Tigit Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OPALIN (NM_001284326) Human Tagged ORF Clone
RG235494 10 µg

OPALIN (NM_001284326) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mono-3-hydroxyisobutyl Phthalate-d4
TRC-M546307-100MG 100 mg

Mono-3-hydroxyisobutyl Phthalate-d4

Sign In for Pricing
View Details