Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC8A3 Rabbit Polyclonal Antibody (FITC)

SLC8A3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NCX3

UniProt

Q96QG2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC8A3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_150287

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOB1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
31970066 1.0 µg DNA

NOB1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Sh3bgr AAV siRNA Pooled Vector
43662166 1.0 µg

Sh3bgr AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit
MBS2510691-01 24 Tests

Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit

Sign In for Pricing
View Details
Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit
MBS2510691-02 48 Tests

Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit

Sign In for Pricing
View Details
Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit
MBS2510691-03 96 Tests

Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit

Sign In for Pricing
View Details
Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit
MBS2510691-04 5x 96 Tests

Guinea pig PTF1alpha (Pancreas Specific Transcription Factor 1alpha) ELISA Kit

Sign In for Pricing
View Details