Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC38A5 Rabbit Polyclonal Antibody (Biotin)

SLC38A5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SN2, JM24, SNAT5, pp7194

UniProt

Q8WUX1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_277053

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RKIP/PEBP1 Antibody, Rabbit Polyclonal
MBS8107437-01 0.1 mL

Anti-RKIP/PEBP1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-RKIP/PEBP1 Antibody, Rabbit Polyclonal
MBS8107437-02 5x 0.1 mL

Anti-RKIP/PEBP1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Human Eotaxin 1 (Eotaxin 1) ELISA Kit
YP-W11305-01 48 Tests

Human Eotaxin 1 (Eotaxin 1) ELISA Kit

Sign In for Pricing
View Details
Human Eotaxin 1 (Eotaxin 1) ELISA Kit
YP-W11305-02 96 Tests

Human Eotaxin 1 (Eotaxin 1) ELISA Kit

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 1 (MCP-1) ELISA Kit
orb1668230-01 48 Tests

Human Monocyte Chemotactic Protein 1 (MCP-1) ELISA Kit

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 1 (MCP-1) ELISA Kit
orb1668230-02 96 Tests

Human Monocyte Chemotactic Protein 1 (MCP-1) ELISA Kit

Sign In for Pricing
View Details