Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A9 Rabbit Polyclonal Antibody (Biotin)

SLC26A9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q7LBE3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC26A9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Taste receptor type 2 member 102 (Tas2r102), partial
MBS7086647 Inquire

Recombinant Rat Taste receptor type 2 member 102 (Tas2r102), partial

Sign In for Pricing
View Details
BTRC, NT (BTRC, BTRCP, FBW1A, FBXW1A, F-box/WD repeat-containing protein 1A, E3RSIkappaB, Epididymis tissue protein Li 2a, F-box and WD repeats protein beta-TrCP, pIkappaBalpha-E3 receptor subunit) (MaxLight 650)
MBS6279316-01 0.1 mL

BTRC, NT (BTRC, BTRCP, FBW1A, FBXW1A, F-box/WD repeat-containing protein 1A, E3RSIkappaB, Epididymis tissue protein Li 2a, F-box and WD repeats protein beta-TrCP, pIkappaBalpha-E3 receptor subunit) (MaxLight 650)

Sign In for Pricing
View Details
BTRC, NT (BTRC, BTRCP, FBW1A, FBXW1A, F-box/WD repeat-containing protein 1A, E3RSIkappaB, Epididymis tissue protein Li 2a, F-box and WD repeats protein beta-TrCP, pIkappaBalpha-E3 receptor subunit) (MaxLight 650)
MBS6279316-02 5x 0.1 mL

BTRC, NT (BTRC, BTRCP, FBW1A, FBXW1A, F-box/WD repeat-containing protein 1A, E3RSIkappaB, Epididymis tissue protein Li 2a, F-box and WD repeats protein beta-TrCP, pIkappaBalpha-E3 receptor subunit) (MaxLight 650)

Sign In for Pricing
View Details
3,4,6-Tri-O-acetyl-2-azido-2-deoxy-a-D-galactopyranosyl bromide - stabilised with 2% CaCO3
MT171263 1 g

3,4,6-Tri-O-acetyl-2-azido-2-deoxy-a-D-galactopyranosyl bromide - stabilised with 2% CaCO3

Sign In for Pricing
View Details
BBS9 Rabbit Polyclonal Antibody
E28PN6420 100 µL

BBS9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCE1L, ID (KCNE1L, AMMECR2, Potassium voltage-gated channel subfamily E member 1-like protein, AMME syndrome candidate gene 2 protein) (MaxLight 550)
MBS6312188-01 0.1 mL

KCE1L, ID (KCNE1L, AMMECR2, Potassium voltage-gated channel subfamily E member 1-like protein, AMME syndrome candidate gene 2 protein) (MaxLight 550)

Sign In for Pricing
View Details