Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A12 Rabbit Polyclonal Antibody (Biotin)

SLC2A12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GLUT8, GLUT12

UniProt

Q8TD20

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC2A12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myeloperoxidase (MPO) Mouse Monoclonal Antibody [Clone ID: OTI3E7]
CF813904 100 µg

Myeloperoxidase (MPO) Mouse Monoclonal Antibody [Clone ID: OTI3E7]

Sign In for Pricing
View Details
4930579J09Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4019308 1.0 µg DNA

4930579J09Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
PLEKHO2, NT (PLEKHO2, PLEKHQ1, Pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1) (MaxLight 550)
MBS6334923-01 0.1 mL

PLEKHO2, NT (PLEKHO2, PLEKHQ1, Pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1) (MaxLight 550)

Sign In for Pricing
View Details
PLEKHO2, NT (PLEKHO2, PLEKHQ1, Pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1) (MaxLight 550)
MBS6334923-02 5x 0.1 mL

PLEKHO2, NT (PLEKHO2, PLEKHQ1, Pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1) (MaxLight 550)

Sign In for Pricing
View Details
Human PSCA, InVivo Block/Neutralizing Antibody
ANT-37396-1mg 1 mg

Human PSCA, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
Human CLD1 ELISA Kit
E101988 1 Each

Human CLD1 ELISA Kit

Sign In for Pricing
View Details