Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC15A4 Rabbit Polyclonal Antibody (Biotin)

SLC15A4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PHT1, PTR4, FP12591

UniProt

Q8N697

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC15A4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663623

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B85-100x15M-569-LB Continuous Tapes for Printers
099163 1 Box (1 Roll x 1 Roll)

B85-100x15M-569-LB Continuous Tapes for Printers

Sign In for Pricing
View Details
Human Protein C (PROC) ELISA Kit
RD-PROC-Hu-48Tests 48 Tests

Human Protein C (PROC) ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 28 ELISA Kit
MBS013046-01 48 Well

Hamster Matrix Metalloproteinase 28 ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 28 ELISA Kit
MBS013046-02 96 Well

Hamster Matrix Metalloproteinase 28 ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 28 ELISA Kit
MBS013046-03 5x 96 Well

Hamster Matrix Metalloproteinase 28 ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 28 ELISA Kit
MBS013046-04 10x 96 Well

Hamster Matrix Metalloproteinase 28 ELISA Kit

Sign In for Pricing
View Details