Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC15A4 Rabbit Polyclonal Antibody (HRP)

SLC15A4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHT1, PTR4, FP12591

UniProt

Q8N697

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC15A4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663623

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDGF-AA Protein (His Tag)
PKSH032905-01 10 µg

Recombinant Human PDGF-AA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PDGF-AA Protein (His Tag)
PKSH032905-02 50 µg

Recombinant Human PDGF-AA Protein (His Tag)

Sign In for Pricing
View Details
MOL1A Antibody
8C11256-AAT 50 µg

MOL1A Antibody

Sign In for Pricing
View Details
Ubxn10 Mouse Gene Knockout Kit (CRISPR)
KN518629 1 Kit

Ubxn10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714569 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS807158 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details