Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A16 Rabbit Polyclonal Antibody (Biotin)

SLC25A16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GDA, GDC, ML7, hML7, HGT.1, D10S105E

UniProt

P16260

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL10 Antibody, HRP conjugated
A61964-50UG 50 µg

CXCL10 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Solute Carrier Family 16, Member 3 (SLC16A3) ELISA Kit
RD-SLC16A3-Hu-01 96 Tests

Human Solute Carrier Family 16, Member 3 (SLC16A3) ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 16, Member 3 (SLC16A3) ELISA Kit
RD-SLC16A3-Hu-02 48 Tests

Human Solute Carrier Family 16, Member 3 (SLC16A3) ELISA Kit

Sign In for Pricing
View Details
RBP4 (NM_006744) Human Recombinant Protein
TP720147XL 1 mg

RBP4 (NM_006744) Human Recombinant Protein

Sign In for Pricing
View Details
TBC1D8 ORF Vector (Human) (pORF)
ORF033728 1.0 µg DNA

TBC1D8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GFAP Antibody
orb2656611-01 20 µg

GFAP Antibody

Sign In for Pricing
View Details