Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A16 Rabbit Polyclonal Antibody (HRP)

SLC25A16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GDA, GDC, ML7, hML7, HGT.1, D10S105E

UniProt

P16260

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF2BP2 Antibody - C-terminal region (ARP66593_P050)
ARP66593_P050 100 µL

IRF2BP2 Antibody - C-terminal region (ARP66593_P050)

Sign In for Pricing
View Details
Ccr5 Antibody
MBS1496521-01 0.05 mg

Ccr5 Antibody

Sign In for Pricing
View Details
Ccr5 Antibody
MBS1496521-02 0.1 mg

Ccr5 Antibody

Sign In for Pricing
View Details
Ccr5 Antibody
MBS1496521-03 5x 0.1 mg

Ccr5 Antibody

Sign In for Pricing
View Details
HPLC Column, C8-Fluorine,3μm,120Å,4.6x30mm
13011490 1 PC

HPLC Column, C8-Fluorine,3μm,120Å,4.6x30mm

Sign In for Pricing
View Details
Human ACVR1 mRNA
HY-174786 500 µg

Human ACVR1 mRNA

Sign In for Pricing
View Details