Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A5 Rabbit Polyclonal Antibody (HRP)

SLC39A5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZIP5, MYP24, LZT-Hs7

UniProt

Q6ZMH5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_775867

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody
abx170443-01 100 µL

Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody
abx170443-02 200 µL

Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody
abx170443-03 1 mL

Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody

Sign In for Pricing
View Details
Hepatitis C Virus RNA-directed RNA polymerase Antibody, Cy5.5 Conjugated
bs-4858R-Cy5.5 100 µL

Hepatitis C Virus RNA-directed RNA polymerase Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Human UGT3A2 knockdown cell line
ABC-KD16527 1 Vial

Human UGT3A2 knockdown cell line

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis rlmE Protein (aa 1-210)
VAng-Lsx4607-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Parapertussis rlmE Protein (aa 1-210)

Sign In for Pricing
View Details