Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A5 Rabbit Polyclonal Antibody (Biotin)

SLC13A5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

INDY, NACT, DEE25, mIndy, EIEE25

UniProt

Q86YT5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC13A5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MepS Antibody
orb821527 2 mg

MepS Antibody

Sign In for Pricing
View Details
Slc13a4 ORF Vector (Rat) (pORF)
43882016 1.0 µg DNA

Slc13a4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
1-Boc-Nipecotic acid
TYD-00018-01 25 g

1-Boc-Nipecotic acid

Sign In for Pricing
View Details
1-Boc-Nipecotic acid
TYD-00018-02 50 g

1-Boc-Nipecotic acid

Sign In for Pricing
View Details
Human Lambda Light Chain (F(ab)2 Fragment) Goat Polyclonal Antibody
R1402AP 500 µg

Human Lambda Light Chain (F(ab)2 Fragment) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
DLR-EG-VEGF-Hu-96T 96 Tests

Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Sign In for Pricing
View Details