Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A5 Rabbit Polyclonal Antibody (HRP)

SLC13A5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INDY, NACT, DEE25, mIndy, EIEE25

UniProt

Q86YT5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC13A5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G3]
TA802044AM 100 µL

EGFR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G3]

Sign In for Pricing
View Details
IL20RB Rabbit Polyclonal Antibody
TA368173 100 µL

IL20RB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trypan Blue (Technical Grade)
TRC-T895523-1G 1 g

Trypan Blue (Technical Grade)

Sign In for Pricing
View Details
Human FBXO6 activation kit by CRISPRa
GA108833 1 Kit

Human FBXO6 activation kit by CRISPRa

Sign In for Pricing
View Details
Isodesmosine Chloride Hydrate (Synthetic)
TRC-I815051-10MG 10 mg

Isodesmosine Chloride Hydrate (Synthetic)

Sign In for Pricing
View Details
Recombinant Human Carbonic Anhydrase 9/CA9 Protein (Fc Tag)
PKSH031872-01 50 µg

Recombinant Human Carbonic Anhydrase 9/CA9 Protein (Fc Tag)

Sign In for Pricing
View Details