Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A5 Rabbit Polyclonal Antibody (HRP)

SLC13A5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INDY, NACT, DEE25, mIndy, EIEE25

UniProt

Q86YT5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC13A5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doublecortin Recombinant Chimeric Antibody Antibody
HA610325 100 µL

Doublecortin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Rnf41 Mouse Gene Knockout Kit (CRISPR)
KN514955 1 Kit

Rnf41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PIM1 (NM_002648) Human Over-expression Lysate
LY419183 100 µg

PIM1 (NM_002648) Human Over-expression Lysate

Sign In for Pricing
View Details
UPF3B Human Gene Knockout Kit (CRISPR)
KN421466 1 Kit

UPF3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nucleolin (364-5), CF405S conjugate, 0.1mg/mL
BNC040527-500 1x 500 µL

Nucleolin (364-5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PPP1R3C activation kit by CRISPRa
GA103710 1 Kit

Human PPP1R3C activation kit by CRISPRa

Sign In for Pricing
View Details